- Recombinant UPF0060 membrane protein Mb2672c (Mb2672c)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1041798
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 11,720 Da
- E Coli or Yeast
- 1-110
- UPF0060 membrane protein Mb2672c (Mb2672c)
Sequence
MVVRSILLFVLAAVAEIGGAWLVWQGVREQRGWLWAGLGVIALGVYGFFATLQPDAHFGRVLAAYGGVFVAGSLAWGMALDGFRPDRWDVIGALGCMAGVAVIMYAPRGH